Antibodies

Jump to Filters
View as table Download
TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: TB21]
AM39040PU-N

USD 570.00

2 Weeks

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified

Applications Assay, ELISA, FC, IHC, NEUT, WB
Reactivities Human
c-Jun (JUN) Rabbit Polyclonal Antibody
TA330130

USD 375.00

5 Days

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP