Antibodies

Jump to Filters
View as table Download
EZH1 Rabbit Polyclonal Antibody
TA335854

USD 375.00

5 Days

Rabbit Polyclonal Anti-EZH1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EZH1 Antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK