EZH1 Rabbit Polyclonal Antibody

CAT#: TA335854

Rabbit Polyclonal Anti-EZH1 Antibody

Product Images

WB Suggested Anti-EZH1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

• 

  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, assay
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EZH1 Antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 85 kDa
• Gene Name: enhancer of zeste 1 polycomb repressive complex 2 subunit
• Database Link:
  NP_001982
  Entrez Gene 2145 Human
  UniProt ID Q92800
• Background: EZH1 is a component of a noncanonical Polycomb repressive complex-2 (PRC2) that mediates methylation of histone H3 (see MIM 602812) lys27 (H3K27) and functions in the maintenance of embryonic stem cell pluripotency and plasticity.
• Synonyms: KMT6B
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Rabbit: 92%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors