Rabbit Polyclonal LPIN1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LPIN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LPIN1. |
Rabbit Polyclonal LPIN1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LPIN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LPIN1. |
Rabbit Polyclonal Anti-LPIN1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPIN1 Antibody: synthetic peptide directed towards the N terminal of human LPIN1. Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK |
Lipin 1 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Lipin 1 |