Antibodies

Jump to Filters
View as table Download
GATA6 Rabbit Polyclonal Antibody
TA329425

USD 375.00

5 Days

Rabbit Polyclonal anti-GATA6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
GATA6 Rabbit Polyclonal Antibody
TA330599

USD 375.00

5 Days

Rabbit Polyclonal Anti-GATA6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR