GATA6 Rabbit Polyclonal Antibody

CAT#: TA329425

Rabbit Polyclonal anti-GATA6 antibody

Product Images

WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

• 

  Rabbit Anti-GATA6 Antibody; Paraffin Embedded Tissue: Human Colon; Antibody Concentration: 5 ug/ml

• 

  The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: WB, IF, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: GATA binding protein 6
• Database Link:
  NP_005248
  Entrez Gene 2627 Human
  UniProt ID Q92908
• Background: GATA6 is thought to be important for regulating terminal differentiation and/or proliferation.
• Synonyms: GATA-binding protein 6; GATA binding protein 6; transcription factor GATA-6
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 93%; Sheep: 93%; Rabbit: 93%; Rat: 86%; Bovine: 86%; Guinea pig: 85%; Mouse: 79%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors