Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Germany
Japan
United Kingdom
China
