Rabbit polyclonal antibody to EED (embryonic ectoderm development)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 229 of EED (Uniprot ID#O75530) |
Rabbit polyclonal antibody to EED (embryonic ectoderm development)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 229 of EED (Uniprot ID#O75530) |
Rabbit Polyclonal Anti-EED Antibody
Applications | IF, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EED antibody: synthetic peptide directed towards the N terminal of human EED. Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC |
Rabbit Polyclonal EED Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EED antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EED. The immunogen is located within amino acids 30 - 80 of EED. |
EED Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EED (NP_003788.2). |
Modifications | Unmodified |