Antibodies

Jump to Filters
View as table Download
TEAD4 Rabbit Polyclonal Antibody
TA333332

USD 375.00

5 Days

Rabbit Polyclonal Anti-TEAD4 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TEAD4 Antibody: synthetic peptide directed towards the middle region of human TEAD4. Synthetic peptide located within the following region: LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEK