Antibodies

Jump to Filters
View as table Download
ASS1 Rabbit Polyclonal Antibody
TA346025

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
ASS1 Rabbit Polyclonal Antibody
TA346024

USD 410.00

5 Days

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
ASS1 Rabbit Polyclonal Antibody
TA308171

USD 415.00

In Stock

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)
ASS1 (196-212) Goat Polyclonal Antibody
AP23046PU-N

USD 440.00

2 Weeks

ASS1 (196-212) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from an internal region of human ASS1
ASS1 (C-term) Rabbit Polyclonal Antibody
AP50278PU-N

USD 450.00

2 Weeks

ASS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 280-310 amino acids from the C-terminal region of human ASS1