Antibodies

View as table Download

Rabbit Polyclonal anti-FOSL1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK

Carrier-free (BSA/glycerol-free) FOSL1 mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FOSL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-16 amino acids of Human FOS-like antigen 1

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FOSL1 (FRA1) mouse monoclonal antibody, clone OTI12F9 (formerly 12F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".