FRA1 (FOSL1) Rabbit Polyclonal Antibody

CAT#: TA329252

Rabbit Polyclonal anti-FOSL1 antibody

Product Images

WB Suggested Anti-FOSL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human Skin lysate tissue at an antibody concentration of 5.0ug/ml using anti-FOSL1 antibody

• 

  Human Skin

• 

  Rabbit Anti-FOSL1 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-FOSL1 Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOSL1 antibody: synthetic peptide directed towards the middle region of human FOSL1. Synthetic peptide located within the following region: TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: FOS like 1, AP-1 transcription factor subunit
• Database Link:
  NP_005429
  Entrez Gene 25445 RatEntrez Gene 8061 Human
  UniProt ID P15407
• Background: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. The FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
• Synonyms: FRA; fra-1; FRA1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Sheep: 85%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Wnt signaling pathway