Antibodies

View as table Download

RCOR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RCOR1

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCOR1 antibody: synthetic peptide directed towards the N terminal of human RCOR1. Synthetic peptide located within the following region: MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASS

Mouse Monoclonal Anti-Co-Rest/RCOR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RCOR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RCOR1 Antibody: synthetic peptide directed towards the middle region of human RCOR1. Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS

Carrier-free (BSA/glycerol-free) RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RCOR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RCOR1

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RCOR1 mouse monoclonal antibody,clone OTI9F6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated