Antibodies

Jump to Filters
View as table Download
OTX2 Rabbit Polyclonal Antibody
TA330538

USD 375.00

5 Days

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF809510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF809511

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA809510

USD 379.00

In Stock

OTX2 mouse monoclonal antibody,clone OTI2B3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
TA809511

USD 379.00

In Stock

OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
OTX2 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
TA809511S

USD 159.00

2 Days

OTX2 mouse monoclonal antibody,clone OTI1A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".