Antibodies

View as table Download

Rabbit Polyclonal Anti-KCTD13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCTD13 antibody: synthetic peptide directed towards the N terminal of human KCTD13. Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Carrier-free (BSA/glycerol-free) KCTD13 mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCTD13 mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCTD13 mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated