POLDIP1 (KCTD13) Rabbit Polyclonal Antibody

CAT#: TA338781

Rabbit Polyclonal Anti-KCTD13 Antibody

Product Images

WB Suggested Anti-KCTD13 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

• 

  Human Brain

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCTD13 antibody: synthetic peptide directed towards the N terminal of human KCTD13. Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: potassium channel tetramerization domain containing 13
• Database Link:
  NP_849194
  Entrez Gene 253980 Human
  UniProt ID Q8WZ19
• Background: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.
• Synonyms: BACURD1; FKSG86; hBACURD1; PDIP1; POLDIP1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Ion Channels: Other, Transcription Factors