Antibodies

Jump to Filters
View as table Download
EYA3 Rabbit Polyclonal Antibody
TA330254

USD 375.00

5 Days

Rabbit Polyclonal Anti-EYA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA