EYA3 Rabbit Polyclonal Antibody
Other products for "EYA3"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 63 kDa |
Gene Name | EYA transcriptional coactivator and phosphatase 3 |
Database Link | |
Background | Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Synonyms | DKFZp686C132 |
Note | Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Phosphatase, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.