Antibodies

Jump to Filters
View as table Download
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308889

USD 415.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)
PLA2G2D (C-term) Rabbit Polyclonal Antibody
AP53324PU-N

USD 450.00

2 Weeks

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA317706

USD 425.00

In Stock

GNAS Rabbit Polyclonal (aa385-394) Antibody

Applications IHC
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen GNAS antibody was raised against synthetic peptide from human GNAS.
G protein alpha S (GNAS) (164-394) Rabbit Polyclonal Antibody
AP23581PU-N

USD 440.00

2 Weeks

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 415.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 310.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
PLA2G3 Rabbit Polyclonal Antibody
TA317692

USD 425.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%).
PLA2G3 Rabbit Polyclonal Antibody
TA317693

USD 425.00

5 Days

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
CF809270

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
CF809271

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323636

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323637

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7H4]
TA809260S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7H4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]
TA809270S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7A6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D7]
TA809271AM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
G protein alpha S (GNAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13D7]
TA809271BM

USD 420.00

4 Weeks

GNAS mouse monoclonal antibody,clone OTI13D7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
TA809271S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI13D7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A4]
TA809314S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI7A4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13G5]
TA809325S

USD 159.00

2 Days

GNAS mouse monoclonal antibody,clone OTI13G5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".