G protein alpha S (GNAS) Rabbit Polyclonal Antibody

CAT#: TA329505

Rabbit Polyclonal anti-GNAS antibody

Product Images

3Hum. Fetal Heart; Host: Rabbit; Target Name: GNAS; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  4Human MCF7; Host: Rabbit; Target Name: NOP56; Sample Tissue: MCF7; Antibody Dilution: 1.0ug/ml; GNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL; Positive Control: HepG2 lysateThere is BioGPS gene expression data showing that GNAS is expressed in HepG2

• 

  WB Suggested Anti-GNAS Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GNAS is expressed in Jurkat

• 

  Human kidney

• 

  Human Lung

• Rabbit Anti-GNAS Antibody; Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: GNAS complex locus
• Database Link:
  NP_536351
  Entrez Gene 14683 MouseEntrez Gene 2778 Human
  UniProt ID P84996
• Background: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.This gene has a highly complex imprinted expression pattern. It encodes maternally, paternally, and biallelically expressed proteins which are derived from alternatively spliced transcripts with alternate 5' exons. Each of the upstream exons is within a differentially methylated region, commonly found in imprinted genes. However, the close proximity (14 kb) of two oppositely expressed promoter regions is unusual. In addition, one of the alternate 5' exons introduces a frameshift relative to the other transcripts, resulting in one isoform which is structurally unrelated to the others. An antisense transcript exists, and may regulate imprinting in this region. Mutations in this gene result in pseudohypoparathyroidism type 1a (PHP1a), which has an atypical autosomal dominant inheritance pattern requiring maternal transmission for full penetrance. There are RefSeqs representing four transcript variants of this gene. Other transcript variants including four additional exons have been described; however, their full length sequences have not been determined.
• Synonyms: AHO; C20orf45; GNAS1; GPSA; GSA; GSP; NESP; PHP1A; PHP1B; PHP1C; POH; SgVI
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Calcium signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Long-term depression, Melanogenesis, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection