Rabbit Polyclonal Antibody against MOP3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
Rabbit Polyclonal Antibody against MOP3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |