Antibodies

Jump to Filters
View as table Download
IL33 Rabbit Polyclonal Antibody
TA339875

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
IL33 Rabbit Polyclonal Antibody
TA328250

USD 285.00

5 Days

Anti-Human IL-33 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-33