IL33 Rabbit Polyclonal Antibody

CAT#: TA339875

Rabbit Polyclonal Anti-IL33 Antibody

Product Images

WB Suggested Anti-IL33 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate

• 

  Skin

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: interleukin 33
• Database Link:
  NP_254274
  Entrez Gene 90865 Human
  UniProt ID O95760
• Background: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.
• Synonyms: C9orf26; DVS27; IL1F11; NF-HEV; NFEHEV
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Cytosolic DNA-sensing pathway