Antibodies

Jump to Filters
View as table Download
SREBP1 (SREBF1) Rabbit Polyclonal Antibody
TA349060

USD 484.00

5 Days

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF2 antibody was raised against a 15 amino acid peptide near the center of human SREBF2.
SREBP1 (SREBF1) Rabbit Polyclonal Antibody
TA330409

USD 375.00

5 Days

Rabbit Polyclonal Anti-SREBF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR