Antibodies

View as table Download

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody,clone OTI3E6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TUBB2A mouse monoclonal antibody,clone OTI3E6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".