beta II Tubulin (TUBB2A) Rabbit Polyclonal Antibody

CAT#: TA345668

Rabbit Polyclonal Anti-TUBB2A Antibody

Product Images

Host: Rabbit; Target Name: TUBB2A; Antibody Dilution: 1.0 ug/ml; Sample Tissue: HepG2 cell lysate.TUBB2A is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Small intestine, myenteric plexus

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: tubulin beta 2A class IIa
• Database Link:
  NP_001060
  Entrez Gene 7280 Human
  UniProt ID Q13885
• Background: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
• Synonyms: CDCBM5; dJ40E16.7; TUBB; TUBB2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Pathogenic Escherichia coli infection