Antibodies

Jump to Filters
View as table Download
STIP1 Rabbit Polyclonal Antibody
TA327005

USD 275.00

3 Weeks

STIP1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human STIP1
STIP1 Rabbit Polyclonal Antibody
TA308465

USD 415.00

In Stock

Rabbit Polyclonal antibody to STIP1 (stress-induced-phosphoprotein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 300 of STIP1 (Uniprot ID#P31948)
STIP1 Rabbit Monoclonal Antibody [Clone ID: EPR6605]
TA310880

USD 528.00

In Stock

Rabbit Monoclonal antibody against STIP1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
STIP1 Rabbit Polyclonal Antibody
TA324736

USD 450.00

5 Days

Rabbit polyclonal STIP1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1.
STIP1 Rabbit Polyclonal Antibody
TA339303

USD 310.00

5 Days

Rabbit Polyclonal Anti-STIP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS