Antibodies

Jump to Filters
View as table Download
MBNL1 Rabbit Polyclonal Antibody
TA344054

USD 475.00

5 Days

Rabbit Polyclonal Anti-MBNL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the middle region of human MBNL1. Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI