MBNL1 Rabbit Polyclonal Antibody

CAT#: TA344054

Rabbit Polyclonal Anti-MBNL1 Antibody

Product Images

WB Suggested Anti-MBNL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate; MBNL1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-MBNL1 Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-MBNL1 Antibody; Paraffin Embedded Tissue: Human cardiac cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the middle region of human MBNL1. Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: muscleblind like splicing regulator 1
• Database Link:
  NP_066368
  Entrez Gene 4154 Human
  UniProt ID Q9NR56
• Background: MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
• Synonyms: EXP; EXP35; EXP40; EXP42; MBNL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 79%