Antibodies

Jump to Filters
View as table Download
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA330316

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLRC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA336852

USD 424.00

5 Days

Rabbit Polyclonal CARD12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human CARD12 protein (between residues 600-700) [UniProt Q9NPP4]
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA336853

USD 479.00

5 Days

Rabbit Polyclonal CARD12 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human CARD12 protein (between residues 950-1015) [UniProt Q9NPP4]
NLRC4 Rabbit Polyclonal Antibody
TA364704

USD 380.00

4 Weeks

NLRC4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NLRC4
NLRC4 Rabbit Polyclonal Antibody
TA369017

USD 380.00

4 Weeks

NLRC4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NLRC4
Nlrc4 Rabbit Polyclonal Antibody
TA379155

USD 220.00

3 Weeks

NLRC4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 89-159 of mouse NLRC4 (NP_001028539.1).
Modifications Unmodified