Antibodies

View as table Download

Rabbit Polyclonal Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS

Goat Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVSVQPNFQQDK, from the internal region of the protein sequence according to NP_000945.3.

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)

Anti-PTGDS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-190 amino acids of human prostaglandin D2 synthase 21kDa (brain)

PTGDS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PTGDS