Antibodies

Jump to Filters
View as table Download
Tfam Rabbit Polyclonal Antibody
TA341820

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-Tfam Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tfam antibody: synthetic peptide directed towards the C terminal of mouse Tfam. Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE
mtTFA (TFAM) Rabbit Polyclonal Antibody
TA332462

USD 275.00

3 Weeks

Rabbit anti-TFAM Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TFAM