Tfam Rabbit Polyclonal Antibody

CAT#: TA341820

Rabbit Polyclonal Anti-Tfam Antibody

Product Images

WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml; Positive Control: SP2/0 cell lysate

• 

  Mouse testicle

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tfam antibody: synthetic peptide directed towards the C terminal of mouse Tfam. Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: transcription factor A, mitochondrial
• Database Link:
  NP_033386
  Entrez Gene 21780 Mouse
  UniProt ID P40630
• Background: TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated thatThis protein is required to regulateThe mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression ofThe gene was eliminated by targeted disruption in heart and muscle cells.
• Synonyms: MTTF1; MtTF1; MTTFA; mtTFA; OTTHUMP00000019633; TCF6; TCF6L1; TCF6L2; TCF6L3
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 79%; Rabbit: 79%