Antibodies

Jump to Filters
View as table Download
MRP4 (ABCC4) Rabbit Polyclonal Antibody
TA327332

USD 275.00

3 Weeks

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4
MRP4 (ABCC4) Goat Polyclonal Antibody
TA302970

USD 375.00

In Stock

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.
VDAC1 Rabbit Polyclonal Antibody
TA308959

USD 415.00

In Stock

Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796)
Kv beta 2 (KCNAB2) Rabbit Polyclonal Antibody
TA331456

USD 375.00

5 Days

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Aquaporin 1 (AQP1) Mouse Monoclonal Antibody [Clone ID: OTI2D10]
TA502357

USD 379.00

In Stock

AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Aquaporin 1 (AQP1) Mouse Monoclonal Antibody [Clone ID: OTI2D10]
TA502357S

USD 159.00

In Stock

AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated