Antibodies

Jump to Filters
View as table Download
CD10 (MME) Rabbit Polyclonal Antibody
TA590055

USD 409.00

In Stock

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
ADAM10 Rabbit Polyclonal Antibody
TA323232

USD 345.00

4 Weeks

Anti-ADAM10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human ADAM metallopeptidase domain 10
CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB235]
UM800127

USD 468.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB235

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB236]
UM800128

USD 468.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB236

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CD10 (MME) Mouse Monoclonal Antibody [Clone ID: UMAB236]
UM870128

USD 180.00

In Stock

MME/CD10 mouse monoclonal antibody, clone UMAB236

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated