Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Anti-ADAM10 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 209 amino acids of human ADAM metallopeptidase domain 10 |
MME/CD10 mouse monoclonal antibody, clone UMAB235
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MME/CD10 mouse monoclonal antibody, clone UMAB236
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MME/CD10 mouse monoclonal antibody, clone UMAB236
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |