Antibodies

View as table Download

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y).
Modifications Phospho-specific

Anti-PTK2B Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.400~404 (D-I-Y-A-E) derived from Human Pyk2.

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications Phospho-specific

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2

Rabbit Polyclonal Vinculin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Vinculin antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Vinculin.

Rabbit Polyclonal Anti-CLDN11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH