Antibodies

Jump to Filters
View as table Download
Dopamine D2 Receptor (DRD2) Rabbit Polyclonal Antibody
TA316680

USD 425.00

5 Days

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
Glucocorticoid Receptor (NR3C1) Rabbit Polyclonal Antibody
TA313373

USD 345.00

In Stock

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).
Dopamine Receptor D1 (DRD1) Rabbit Polyclonal Antibody
TA317650

USD 425.00

In Stock

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).
EDG3 (S1PR3) Rabbit Polyclonal Antibody
TA321693

USD 345.00

4 Weeks

Anti-S1PR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 222-236 amino acids of human sphingosine-1-phosphate receptor 3
Melatonin Receptor 1A (MTNR1A) Rabbit Polyclonal Antibody
TA321735

USD 345.00

4 Weeks

Anti-MTNR1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A
Somatostatin Receptor 3 (SSTR3) Rabbit Polyclonal Antibody
TA323276

USD 345.00

In Stock

Anti-SSTR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA351107

USD 345.00

In Stock

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL