Antibodies

Jump to Filters
View as table Download
GCNT3 Rabbit Polyclonal Antibody
TA332087

USD 310.00

5 Days

Rabbit Polyclonal Anti-GCNT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL