Antibodies

View as table Download

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1

CLIC1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Modifications Unmodified