Rabbit polyclonal His6-DEP-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Poly-HIS protein were used to produced this antibody. |
Rabbit polyclonal His6-DEP-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Poly-HIS protein were used to produced this antibody. |
Rabbit Polyclonal Anti-ACP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Rabbit Polyclonal PTPN1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment |
PTPRM Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Anti-PTPN6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Anti-PTPRJ Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1323-1337 amino acids of Human protein tyrosine phosphatase, receptor type, J |
Anti-PTPRJ Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1323-1337 amino acids of Human protein tyrosine phosphatase, receptor type, J |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |
Anti-PTPRM Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1370-1385 amino acids of Human protein tyrosine phosphatase, receptor type, M |