Antibodies

Jump to Filters
View as table Download
SET Rabbit Polyclonal Antibody
TA308954

USD 415.00

In Stock

Rabbit Polyclonal antibody to SET (SET nuclear oncogene)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of SET
SET Rabbit Polyclonal Antibody
TA342203

USD 375.00

5 Days

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
TSTD3 (TAF-I beta) Rabbit Polyclonal Antibody
AP20445PU-N

USD 370.00

2 Weeks

TSTD3 (TAF-I beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat
TSTD3 (N-term) Goat Polyclonal Antibody
AP23073PU-N

USD 440.00

2 Weeks

TSTD3 (N-term) goat polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Chicken, Human
Immunogen Synthetic peptide from N-terminus of human SET