Antibodies

View as table Download

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

Rabbit Polyclonal DEC2/SHARP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9]

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1