Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 4 (GPX4) Rabbit Polyclonal Antibody
TA344322

USD 475.00

5 Days

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Glutathione Peroxidase 4 (GPX4) Goat Polyclonal Antibody
TA303125

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1.