Antibodies

Jump to Filters
View as table Download
VMAT2 (SLC18A2) Rabbit Polyclonal Antibody
TA309861

USD 555.00

In Stock

Rabbit Polyclonal VMAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]
VMAT2 (SLC18A2) Rabbit Polyclonal Antibody
TA334042

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC18A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
VMAT2 (SLC18A2) Rabbit Polyclonal Antibody
TA321553

USD 345.00

2 Weeks

Anti-SLC18A2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2