Antibodies

View as table Download

Rabbit Polyclonal Anti-BSDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Rabbit Polyclonal antibody to UBE2L3 (ubiquitin-conjugating enzyme E2L 3)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 154 of UBE2L3 (Uniprot ID#P68036)

UBE2L3 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2L3

UBE2L3 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3