Antibodies

Jump to Filters
View as table Download
SRP19 Rabbit Polyclonal Antibody
TA345833

USD 410.00

5 Days

Rabbit Polyclonal Anti-SRP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK