Antibodies

View as table Download

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

PHPT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHPT1

Rabbit Polyclonal ACP6 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal antibody to TRAP (acid phosphatase 5, tartrate resistant)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 28 and 325 of TRAP (Uniprot ID#P13686)

Goat Anti-ENPP1 / PC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHLPTFSQED, from the C Terminus of the protein sequence according to NP_006199.2.

Rabbit Polyclonal Antibody against PHPT1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Dog, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%).

CD203c Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%).

CD203c Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%).

Goat Polyclonal ENPP-1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human ENPP1 protein (between residues 900-925) [UniProt P22413]

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Anti-ENPP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7

Rabbit Polyclonal Anti-ACP6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ACP6

Rabbit Polyclonal Anti-ACPT Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACPT

ACP2 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACP2