Antibodies

Jump to Filters
View as table Download
Annexin IV (ANXA4) Rabbit Polyclonal Antibody
TA349236

USD 380.00

In Stock

Rabbit Polyclonal Anti-ANXA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA4
Annexin IV (ANXA4) (N-term) Rabbit Polyclonal Antibody
AP23295PU-N

USD 405.00

2 Weeks

Annexin IV (ANXA4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human Annexin IV
Annexin IV (ANXA4) Rabbit Polyclonal Antibody
TA341702

USD 310.00

5 Days

Rabbit Polyclonal Anti-ANXA4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
ANXA4 Rabbit Polyclonal Antibody
TA364414

USD 380.00

4 Weeks

ANXA4 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ANXA4