Antibodies

Jump to Filters
View as table Download
CLIC1 Rabbit Polyclonal Antibody
AP14246PU-N

USD 450.00

2 Weeks

CLIC1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a recombinant human CLIC1 protein.
CLIC1 Rabbit Polyclonal Antibody
TA338517

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1. Synthetic peptide located within the following region: GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
CLIC1 Rabbit Polyclonal Antibody
TA350202

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLIC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CLIC1
CLIC1 Rabbit Polyclonal Antibody
TA374874

USD 220.00

3 Weeks

CLIC1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-241 of human CLIC1 (NP_001279.2).
Modifications Unmodified