Antibodies

Jump to Filters
View as table Download
FGD1 Rabbit Polyclonal Antibody
TA329379

USD 375.00

5 Days

Rabbit Polyclonal anti-FGD1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
FGD1 Rabbit Polyclonal Antibody
TA376214

USD 220.00

3 Weeks

FGD1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2).
Modifications Unmodified